| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010930-M01 |
| Product name: | APOBEC2 monoclonal antibody (M01), clone 4D7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant APOBEC2. |
| Clone: | 4D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10930 |
| Gene name: | APOBEC2 |
| Gene alias: | ARCD1|ARP1 |
| Gene description: | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 |
| Genbank accession: | NM_006789.2 |
| Immunogen: | APOBEC2 (NP_006780.1, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK |
| Protein accession: | NP_006780.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of APOBEC2 expression in transfected 293T cell line by APOBEC2 monoclonal antibody (M01), clone 4D7. Lane 1: APOBEC2 transfected lysate (Predicted MW: 25.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |