Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DBF4 monoclonal antibody (M01), clone 6G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about DBF4 monoclonal antibody (M01), clone 6G9
| Brand: | Abnova |
| Reference: | H00010926-M01 |
| Product name: | DBF4 monoclonal antibody (M01), clone 6G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DBF4. |
| Clone: | 6G9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10926 |
| Gene name: | DBF4 |
| Gene alias: | ASK|CHIF|DBF4A|ZDBF1 |
| Gene description: | DBF4 homolog (S. cerevisiae) |
| Genbank accession: | NM_006716 |
| Immunogen: | DBF4 (NP_006707, 2 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT |
| Protein accession: | NP_006707 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DBF4 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Transcriptional Co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.Hughes S, Jenkins V, Dar MJ, Engelman A, Cherepanov P. J Biol Chem. 2010 Jan 1;285(1):541-54. Epub 2009 Oct 28. |