Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EDAR monoclonal antibody (M01), clone 6C12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
More info about EDAR monoclonal antibody (M01), clone 6C12
| Brand: | Abnova |
| Reference: | H00010913-M01 |
| Product name: | EDAR monoclonal antibody (M01), clone 6C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EDAR. |
| Clone: | 6C12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10913 |
| Gene name: | EDAR |
| Gene alias: | DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390 |
| Gene description: | ectodysplasin A receptor |
| Genbank accession: | NM_022336 |
| Immunogen: | EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL |
| Protein accession: | NP_071731 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EDAR monoclonal antibody (M01), clone 6C12. Western Blot analysis of EDAR expression in human kidney. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |