Brand: | Abnova |
Reference: | H00010913-M01 |
Product name: | EDAR monoclonal antibody (M01), clone 6C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDAR. |
Clone: | 6C12 |
Isotype: | IgG2b Kappa |
Gene id: | 10913 |
Gene name: | EDAR |
Gene alias: | DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390 |
Gene description: | ectodysplasin A receptor |
Genbank accession: | NM_022336 |
Immunogen: | EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL |
Protein accession: | NP_071731 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EDAR monoclonal antibody (M01), clone 6C12. Western Blot analysis of EDAR expression in human kidney. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |