No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Polyclonal |
Host species | Mouse |
Applications | ELISA,WB-Re |
Reference: | H00010910-A03 |
Product name: | SUGT1 polyclonal antibody (A03) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SUGT1. |
Gene id: | 10910 |
Gene name: | SUGT1 |
Gene alias: | SGT1 |
Gene description: | SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) |
Genbank accession: | NM_006704 |
Immunogen: | SUGT1 (NP_006695, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG |
Protein accession: | NP_006695 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |