Cart 27 Product Products 10 495,16 € (empty)
No products
To be determined Shipping
10 495,16 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 27 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 495,16 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 495,16 €
Data sheet of SUGT1 polyclonal antibody (A03)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SUGT1 polyclonal antibody (A03)
| Reference: | H00010910-A03 |
| Product name: | SUGT1 polyclonal antibody (A03) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SUGT1. |
| Gene id: | 10910 |
| Gene name: | SUGT1 |
| Gene alias: | SGT1 |
| Gene description: | SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) |
| Genbank accession: | NM_006704 |
| Immunogen: | SUGT1 (NP_006695, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG |
| Protein accession: | NP_006695 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |