| Brand: | Abnova |
| Reference: | H00010907-M01 |
| Product name: | TXNL4A monoclonal antibody (M01), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TXNL4A. |
| Clone: | 1C4 |
| Isotype: | IgG1 kappa |
| Gene id: | 10907 |
| Gene name: | TXNL4A |
| Gene alias: | DIB1|DIM1|HsT161|TXNL4|U5-15kD |
| Gene description: | thioredoxin-like 4A |
| Genbank accession: | BC001046 |
| Immunogen: | TXNL4A (AAH01046, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY |
| Protein accession: | AAH01046 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TXNL4A is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |