Brand: | Abnova |
Reference: | H00010907-M01 |
Product name: | TXNL4A monoclonal antibody (M01), clone 1C4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TXNL4A. |
Clone: | 1C4 |
Isotype: | IgG1 kappa |
Gene id: | 10907 |
Gene name: | TXNL4A |
Gene alias: | DIB1|DIM1|HsT161|TXNL4|U5-15kD |
Gene description: | thioredoxin-like 4A |
Genbank accession: | BC001046 |
Immunogen: | TXNL4A (AAH01046, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY |
Protein accession: | AAH01046 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.36 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TXNL4A is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |