Brand: | Abnova |
Reference: | H00010902-M01 |
Product name: | BRD8 monoclonal antibody (M01), clone 3G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BRD8. |
Clone: | 3G8 |
Isotype: | IgG2b Kappa |
Gene id: | 10902 |
Gene name: | BRD8 |
Gene alias: | SMAP|SMAP2|p120 |
Gene description: | bromodomain containing 8 |
Genbank accession: | NM_139199 |
Immunogen: | BRD8 (NP_631938, 33 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL |
Protein accession: | NP_631938 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to BRD8 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |