No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010899-A01 |
Product name: | JTB polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant JTB. |
Gene id: | 10899 |
Gene name: | JTB |
Gene alias: | HJTB|HSPC222|PAR|hJT |
Gene description: | jumping translocation breakpoint |
Genbank accession: | BC000996 |
Immunogen: | JTB (AAH00996.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI |
Protein accession: | AAH00996.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.17 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | JTB polyclonal antibody (A01), Lot # NBI0061124QCS1 Western Blot analysis of JTB expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |