No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00010898-B02P |
Product name: | CPSF4 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CPSF4 protein. |
Gene id: | 10898 |
Gene name: | CPSF4 |
Gene alias: | CPSF30|NAR|NEB1 |
Gene description: | cleavage and polyadenylation specific factor 4, 30kDa |
Genbank accession: | BC050738 |
Immunogen: | CPSF4 (AAH50738.1, 1 a.a. ~ 243 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ |
Protein accession: | AAH50738.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CPSF4 expression in transfected 293T cell line (H00010898-T03) by CPSF4 MaxPab polyclonal antibody. Lane 1: CPSF4 transfected lysate(26.73 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |