| Brand: | Abnova |
| Reference: | H00010891-M18 |
| Product name: | PPARGC1A monoclonal antibody (M18), clone 2F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPARGC1A. |
| Clone: | 2F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10891 |
| Gene name: | PPARGC1A |
| Gene alias: | LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1 |
| Gene description: | peroxisome proliferator-activated receptor gamma, coactivator 1 alpha |
| Genbank accession: | NM_013261 |
| Immunogen: | PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR |
| Protein accession: | NP_037393 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PPARGC1A is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |