Brand: | Abnova |
Reference: | H00010880-M01 |
Product name: | ACTL7B monoclonal antibody (M01), clone 6A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ACTL7B. |
Clone: | 6A4 |
Isotype: | IgG2a Kappa |
Gene id: | 10880 |
Gene name: | ACTL7B |
Gene alias: | - |
Gene description: | actin-like 7B |
Genbank accession: | NM_006686 |
Immunogen: | ACTL7B (NP_006677, 286 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK |
Protein accession: | NP_006677 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ACTL7B monoclonal antibody (M01), clone 6A4 Western Blot analysis of ACTL7B expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |