ACTL7B monoclonal antibody (M01), clone 6A4 View larger

ACTL7B monoclonal antibody (M01), clone 6A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTL7B monoclonal antibody (M01), clone 6A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ACTL7B monoclonal antibody (M01), clone 6A4

Brand: Abnova
Reference: H00010880-M01
Product name: ACTL7B monoclonal antibody (M01), clone 6A4
Product description: Mouse monoclonal antibody raised against a partial recombinant ACTL7B.
Clone: 6A4
Isotype: IgG2a Kappa
Gene id: 10880
Gene name: ACTL7B
Gene alias: -
Gene description: actin-like 7B
Genbank accession: NM_006686
Immunogen: ACTL7B (NP_006677, 286 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK
Protein accession: NP_006677
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010880-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010880-M01-1-1-1.jpg
Application image note: ACTL7B monoclonal antibody (M01), clone 6A4 Western Blot analysis of ACTL7B expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACTL7B monoclonal antibody (M01), clone 6A4 now

Add to cart