Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMR3B purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about SMR3B purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010879-B01P |
| Product name: | SMR3B purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SMR3B protein. |
| Gene id: | 10879 |
| Gene name: | SMR3B |
| Gene alias: | MGC104379|P-B|PBII|PRL3|PROL3|SMR1B |
| Gene description: | submaxillary gland androgen regulated protein 3B |
| Genbank accession: | BC015327 |
| Immunogen: | SMR3B (AAH15327, 1 a.a. ~ 79 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP |
| Protein accession: | AAH15327 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SMR3B expression in transfected 293T cell line (H00010879-T01) by SMR3B MaxPab polyclonal antibody. Lane 1: SMR3B transfected lysate(8.69 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |