No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010876-M01 |
Product name: | FAM12A monoclonal antibody (M01), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FAM12A. |
Clone: | 3D9 |
Isotype: | IgG1 Kappa |
Gene id: | 10876 |
Gene name: | FAM12A |
Gene alias: | EP3A|HE3-ALPHA|HE3A|HE3ALPHA|MGC119614|MGC119615 |
Gene description: | family with sequence similarity 12, member A |
Genbank accession: | NM_006683.4 |
Immunogen: | FAM12A (NP_006674.2, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN |
Protein accession: | NP_006674.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |