| Brand: | Abnova |
| Reference: | H00010875-M01 |
| Product name: | FGL2 monoclonal antibody (M01), clone 6D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FGL2. |
| Clone: | 6D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10875 |
| Gene name: | FGL2 |
| Gene alias: | T49|pT49 |
| Gene description: | fibrinogen-like 2 |
| Genbank accession: | NM_006682 |
| Immunogen: | FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG |
| Protein accession: | NP_006673 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | C5a/C5aR pathway is essential for the pathogenesis of murine viral fulminant hepatitis via potentiating Fgl2/fibroleukin expression.Xu GL, Chen J, Yang F, Li GQ, Zheng LX, Wu YZ Hepatology. 2014 Jul;60(1):114-24. doi: 10.1002/hep.27114. Epub 2014 May 28. |