| Brand: | Abnova |
| Reference: | H00010871-M01 |
| Product name: | CD300C monoclonal antibody (M01), clone 2A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD300C. |
| Clone: | 2A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10871 |
| Gene name: | CD300C |
| Gene alias: | CMRF-35A|CMRF35|CMRF35A|CMRF35A1|IGSF16|LIR |
| Gene description: | CD300c molecule |
| Genbank accession: | NM_006678 |
| Immunogen: | CD300C (NP_006669, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVS |
| Protein accession: | NP_006669 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CD300C is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |