Cart 2 Product Products 375,67 € (empty)
No products
To be determined Shipping
375,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 375,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 375,67 €
Data sheet of USP20 monoclonal antibody (M01), clone 1A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about USP20 monoclonal antibody (M01), clone 1A6
| Brand: | Abnova |
| Reference: | H00010868-M01 |
| Product name: | USP20 monoclonal antibody (M01), clone 1A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant USP20. |
| Clone: | 1A6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10868 |
| Gene name: | USP20 |
| Gene alias: | KIAA1003|LSFR3A|VDU2 |
| Gene description: | ubiquitin specific peptidase 20 |
| Genbank accession: | NM_001008563 |
| Immunogen: | USP20 (NP_001008563, 252 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD |
| Protein accession: | NP_001008563 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |