Cart 42 Product Products 27 967,38 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x IFN-gamma534,00 € -
-
1 x Phospho-Fl...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
1 x Interleuki...469,00 € -
-
No products
To be determined Shipping
27 967,38 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 42 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 967,38 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 967,38 €
Data sheet of HCP5 monoclonal antibody (M11), clone 3G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about HCP5 monoclonal antibody (M11), clone 3G7
| Brand: | Abnova |
| Reference: | H00010866-M11 |
| Product name: | HCP5 monoclonal antibody (M11), clone 3G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HCP5. |
| Clone: | 3G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10866 |
| Gene name: | HCP5 |
| Gene alias: | D6S2650E|P5-1 |
| Gene description: | HLA complex P5 |
| Genbank accession: | NM_006674 |
| Immunogen: | HCP5 (NP_006665, 3 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVS |
| Protein accession: | NP_006665 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HCP5 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |