Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD3EAP (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Human |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about CD3EAP (Human) Recombinant Protein (Q01)
| Reference: | H00010849-Q01 |
| Product name: | CD3EAP (Human) Recombinant Protein (Q01) |
| Product description: | Human CD3EAP partial ORF ( NP_036231, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 10849 |
| Gene name: | CD3EAP |
| Gene alias: | ASE-1|CAST|MGC118851|PAF49 |
| Gene description: | CD3e molecule, epsilon associated protein |
| Genbank accession: | NM_012099 |
| Immunogen sequence/protein sequence: | EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA |
| Protein accession: | NP_036231 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |