| Reference: | H00010849-M05 |
| Product name: | CD3EAP monoclonal antibody (M05), clone 6A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CD3EAP. |
| Clone: | 6A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10849 |
| Gene name: | CD3EAP |
| Gene alias: | ASE-1|CAST|MGC118851|PAF49 |
| Gene description: | CD3e molecule, epsilon associated protein |
| Genbank accession: | NM_012099 |
| Immunogen: | CD3EAP (NP_036231, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASA |
| Protein accession: | NP_036231 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |