No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010801-A01 |
| Product name: | SEPT9 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SEPT9. |
| Gene id: | 10801 |
| Gene name: | SEPT9 |
| Gene alias: | AF17q25|FLJ75490|KIAA0991|MSF|MSF1|NAPB|PNUTL4|SINT1|SeptD1 |
| Gene description: | septin 9 |
| Genbank accession: | BC021192 |
| Immunogen: | SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP |
| Protein accession: | AAH21192 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | SEPT9 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of SEPT9 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The Influence of Methylated Septin 9 Gene on RNA and Protein Level in Colorectal Cancer.Toth K, Galamb O, Spisak S, Wichmann B, Sipos F, Valcz G, Leiszter K, Molnar B, Tulassay Z. Pathol Oncol Res. 2011 Jan 26. [Epub ahead of print] |