No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00010799-M03 |
Product name: | RPP40 monoclonal antibody (M03), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPP40. |
Clone: | 1G8 |
Isotype: | IgG2b Kappa |
Gene id: | 10799 |
Gene name: | RPP40 |
Gene alias: | RNASEP1|bA428J1.3 |
Gene description: | ribonuclease P/MRP 40kDa subunit |
Genbank accession: | NM_006638 |
Immunogen: | RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP |
Protein accession: | NP_006629 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged RPP40 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |