Brand: | Abnova |
Reference: | H00010799-A01 |
Product name: | RPP40 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RPP40. |
Gene id: | 10799 |
Gene name: | RPP40 |
Gene alias: | RNASEP1|bA428J1.3 |
Gene description: | ribonuclease P/MRP 40kDa subunit |
Genbank accession: | NM_006638 |
Immunogen: | RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP |
Protein accession: | NP_006629 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |