| Brand: | Abnova |
| Reference: | H00010782-A01 |
| Product name: | ZNF274 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ZNF274. |
| Gene id: | 10782 |
| Gene name: | ZNF274 |
| Gene alias: | DKFZp686K08243|FLJ37843|HFB101|ZF2|ZKSCAN19 |
| Gene description: | zinc finger protein 274 |
| Genbank accession: | NM_133502 |
| Immunogen: | ZNF274 (NP_598009, 420 a.a. ~ 530 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT |
| Protein accession: | NP_598009 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | ZNF274 recruits the histone methyltransferase SETDB1 to the 3' ends of ZNF genes.Frietze S, O'Geen H, Blahnik KR, Jin VX, Farnham PJ. PLoS One. 2010 Dec 8;5(12):e15082. |