No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00010781-M02 |
Product name: | ZNF266 monoclonal antibody (M02), clone 4G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF266. |
Clone: | 4G5 |
Isotype: | IgG2a Kappa |
Gene id: | 10781 |
Gene name: | ZNF266 |
Gene alias: | HZF1 |
Gene description: | zinc finger protein 266 |
Genbank accession: | NM_006631 |
Immunogen: | ZNF266 (NP_006622.2, 274 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIH |
Protein accession: | NP_006622.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZNF266 expression in transfected 293T cell line by ZNF266 monoclonal antibody (M02), clone 4G5. Lane 1: ZNF266 transfected lysate(29.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |