No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Reference: | H00010773-M04 |
Product name: | ZBTB6 monoclonal antibody (M04), clone 2E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB6. |
Clone: | 2E12 |
Isotype: | IgG2b Kappa |
Gene id: | 10773 |
Gene name: | ZBTB6 |
Gene alias: | ZID|ZNF482 |
Gene description: | zinc finger and BTB domain containing 6 |
Genbank accession: | NM_006626 |
Immunogen: | ZBTB6 (NP_006617.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EALSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICIL |
Protein accession: | NP_006617.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |