| Reference: | H00010773-M04 |
| Product name: | ZBTB6 monoclonal antibody (M04), clone 2E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB6. |
| Clone: | 2E12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10773 |
| Gene name: | ZBTB6 |
| Gene alias: | ZID|ZNF482 |
| Gene description: | zinc finger and BTB domain containing 6 |
| Genbank accession: | NM_006626 |
| Immunogen: | ZBTB6 (NP_006617.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EALSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICIL |
| Protein accession: | NP_006617.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |