Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLK2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PLK2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010769-A01 |
| Product name: | PLK2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PLK2. |
| Gene id: | 10769 |
| Gene name: | PLK2 |
| Gene alias: | SNK |
| Gene description: | polo-like kinase 2 (Drosophila) |
| Genbank accession: | BC013879 |
| Immunogen: | PLK2 (AAH13879, 585 a.a. ~ 685 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQRCN |
| Protein accession: | AAH13879 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Calcipotriol Affects Keratinocyte Proliferation by Decreasing Expression of Early Growth Response-1 and Polo-like Kinase-2.Kristl J, Slanc P, Krasna M, Berlec A, Jeras M, Strukelj B. Pharm Res. 2008 Mar;25(3):521-9. Epub 2007 Aug 2. |