Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 286,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 286,00 €
Data sheet of AHCYL1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about AHCYL1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010768-A01 |
| Product name: | AHCYL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AHCYL1. |
| Gene id: | 10768 |
| Gene name: | AHCYL1 |
| Gene alias: | DCAL|IRBIT|PRO0233|XPVKONA |
| Gene description: | S-adenosylhomocysteine hydrolase-like 1 |
| Genbank accession: | NM_006621 |
| Immunogen: | AHCYL1 (NP_006612, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG |
| Protein accession: | NP_006612 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | IRBIT reduces the apparent affinity for intracellular Mg(2+) in inhibition of the electrogenic Na(+)-HCO(3)(-) cotransporter NBCe1-B.Yamaguchi S, Ishikawa T. Biochem Biophys Res Commun. 2012 Jul 3. |