Brand: | Abnova |
Reference: | H00010762-M01 |
Product name: | NUP50 monoclonal antibody (M01), clone 4H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NUP50. |
Clone: | 4H7 |
Isotype: | IgG2b Kappa |
Gene id: | 10762 |
Gene name: | NUP50 |
Gene alias: | MGC39961|NPAP60|NPAP60L |
Gene description: | nucleoporin 50kDa |
Genbank accession: | NM_153645 |
Immunogen: | NUP50 (NP_705931.1, 342 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD |
Protein accession: | NP_705931.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NUP50 monoclonal antibody (M01), clone 4H7. Western Blot analysis of NUP50 expression in Hela S3 NE. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |