Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RGS19IP1 polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about RGS19IP1 polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00010755-A02 |
| Product name: | RGS19IP1 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GIPC1. |
| Gene id: | 10755 |
| Gene name: | GIPC1 |
| Gene alias: | C19orf3|GIPC|GLUT1CBP|Hs.6454|IIP-1|MGC15889|MGC3774|NIP|RGS19IP1|SEMCAP|SYNECTIIN|SYNECTIN|TIP-2 |
| Gene description: | GIPC PDZ domain containing family, member 1 |
| Genbank accession: | NM_005716 |
| Immunogen: | GIPC1 (NP_005707, 61 a.a. ~ 158 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIK |
| Protein accession: | NP_005707 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RGS19IP1 polyclonal antibody (A02), Lot # 050928JC01 Western Blot analysis of GIPC1 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |