View larger

CHL1 monoclonal antibody (M02), clone 2H5

Reference:

Condition: New product

Data sheet of CHL1 monoclonal antibody (M02), clone 2H5

Brand:	Abnova
Reference:	H00010752-M02
Product name:	CHL1 monoclonal antibody (M02), clone 2H5
Product description:	Mouse monoclonal antibody raised against a partial recombinant CHL1.
Clone:	2H5
Isotype:	IgG2a Kappa
Gene id:	10752
Gene name:	CHL1
Gene alias:	CALL\|FLJ44930\|L1CAM2\|MGC132578
Gene description:	cell adhesion molecule with homology to L1CAM (close homolog of L1)
Genbank accession:	NM_006614
Immunogen:	CHL1 (NP_006605, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Protein accession:	NP_006605
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.84 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged CHL1 is 0.3 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice