Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHL1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CHL1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010752-A01 |
| Product name: | CHL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CHL1. |
| Gene id: | 10752 |
| Gene name: | CHL1 |
| Gene alias: | CALL|FLJ44930|L1CAM2|MGC132578 |
| Gene description: | cell adhesion molecule with homology to L1CAM (close homolog of L1) |
| Genbank accession: | NM_006614 |
| Immunogen: | CHL1 (NP_006605, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK |
| Protein accession: | NP_006605 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CHL1 polyclonal antibody (A01), Lot # SAC4060428QCS1 Western Blot analysis of CHL1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Neural recognition molecules CHL1 and NB-3 regulate apical dendrite orientation in the neocortex via PTPalpha.Ye H, Tan YL, Ponniah S, Takeda Y, Wang SQ, Schachner M, Watanabe K, Pallen CJ, Xiao ZC. EMBO J. 2008 Jan 9;27(1):188-200. Epub 2007 Nov 29. |