KIF1C monoclonal antibody (M06), clone 1F12 View larger

KIF1C monoclonal antibody (M06), clone 1F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIF1C monoclonal antibody (M06), clone 1F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about KIF1C monoclonal antibody (M06), clone 1F12

Brand: Abnova
Reference: H00010749-M06
Product name: KIF1C monoclonal antibody (M06), clone 1F12
Product description: Mouse monoclonal antibody raised against a partial recombinant KIF1C.
Clone: 1F12
Isotype: IgG1 Kappa
Gene id: 10749
Gene name: KIF1C
Gene alias: KIAA0706|LTXS1
Gene description: kinesin family member 1C
Genbank accession: NM_006612
Immunogen: KIF1C (NP_006603, 1004 a.a. ~ 1103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDLKESGAAV
Protein accession: NP_006603
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010749-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010749-M06-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to KIF1C on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KIF1C monoclonal antibody (M06), clone 1F12 now

Add to cart