Brand: | Abnova |
Reference: | H00010741-M01 |
Product name: | RBBP9 monoclonal antibody (M01), clone 2A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBBP9. |
Clone: | 2A11 |
Isotype: | IgG2a Kappa |
Gene id: | 10741 |
Gene name: | RBBP9 |
Gene alias: | BOG|MGC9236|RBBP10 |
Gene description: | retinoblastoma binding protein 9 |
Genbank accession: | NM_006606 |
Immunogen: | RBBP9 (NP_006597, 87 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP |
Protein accession: | NP_006597 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to RBBP9 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |