RBBP9 monoclonal antibody (M01), clone 2A11 View larger

RBBP9 monoclonal antibody (M01), clone 2A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBBP9 monoclonal antibody (M01), clone 2A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about RBBP9 monoclonal antibody (M01), clone 2A11

Brand: Abnova
Reference: H00010741-M01
Product name: RBBP9 monoclonal antibody (M01), clone 2A11
Product description: Mouse monoclonal antibody raised against a partial recombinant RBBP9.
Clone: 2A11
Isotype: IgG2a Kappa
Gene id: 10741
Gene name: RBBP9
Gene alias: BOG|MGC9236|RBBP10
Gene description: retinoblastoma binding protein 9
Genbank accession: NM_006606
Immunogen: RBBP9 (NP_006597, 87 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP
Protein accession: NP_006597
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010741-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010741-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to RBBP9 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RBBP9 monoclonal antibody (M01), clone 2A11 now

Add to cart