View larger

STAG2 monoclonal antibody (M01), clone 3C6

Reference:

Condition: New product

Data sheet of STAG2 monoclonal antibody (M01), clone 3C6

Brand:	Abnova
Reference:	H00010735-M01
Product name:	STAG2 monoclonal antibody (M01), clone 3C6
Product description:	Mouse monoclonal antibody raised against a partial recombinant STAG2.
Clone:	3C6
Isotype:	IgG1 Kappa
Gene id:	10735
Gene name:	STAG2
Gene alias:	DKFZp686P168\|DKFZp781H1753\|FLJ25871\|SA-2\|SA2\|bA517O1.1
Gene description:	stromal antigen 2
Genbank accession:	NM_006603
Immunogen:	STAG2 (NP_006594.3, 1130 a.a. ~ 1231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	KRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVSMF
Protein accession:	NP_006594.3
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.96 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse
Application image:
Application image note:	Immunoperoxidase of monoclonal antibody to STAG2 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Applications:	WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition:	Dry Ice