Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 769,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 769,00 €
Data sheet of PLK4 monoclonal antibody (M01), clone 1C8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about PLK4 monoclonal antibody (M01), clone 1C8
| Brand: | Abnova |
| Reference: | H00010733-M01 |
| Product name: | PLK4 monoclonal antibody (M01), clone 1C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLK4. |
| Clone: | 1C8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10733 |
| Gene name: | PLK4 |
| Gene alias: | SAK|STK18 |
| Gene description: | polo-like kinase 4 (Drosophila) |
| Genbank accession: | BC036023 |
| Immunogen: | PLK4 (AAH36023, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSE |
| Protein accession: | AAH36023 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PLK4 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |