No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010728-M01 |
Product name: | TEBP monoclonal antibody (M01), clone 3H1-2A8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TEBP. |
Clone: | 3H1-2A8 |
Isotype: | IgG2a kappa |
Gene id: | 10728 |
Gene name: | PTGES3 |
Gene alias: | P23|TEBP|cPGES |
Gene description: | prostaglandin E synthase 3 (cytosolic) |
Genbank accession: | BC003005 |
Immunogen: | TEBP (AAH03005, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Protein accession: | AAH03005 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (43.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TEBP monoclonal antibody (M01), clone 3H1-2A8 Western Blot analysis of TEBP expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |