PTGES3 polyclonal antibody (A01) View larger

PTGES3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTGES3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PTGES3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010728-A01
Product name: PTGES3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant PTGES3.
Gene id: 10728
Gene name: PTGES3
Gene alias: P23|TEBP|cPGES
Gene description: prostaglandin E synthase 3 (cytosolic)
Genbank accession: BC003005
Immunogen: PTGES3 (AAH03005, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Protein accession: AAH03005
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010728-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.71 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTGES3 polyclonal antibody (A01) now

Add to cart