| Brand: | Abnova |
| Reference: | H00010726-A01 |
| Product name: | NUDC polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant NUDC. |
| Gene id: | 10726 |
| Gene name: | NUDC |
| Gene alias: | HNUDC|MNUDC|NPD011 |
| Gene description: | nuclear distribution gene C homolog (A. nidulans) |
| Genbank accession: | BC002399 |
| Immunogen: | NUDC (AAH02399, 1 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEGEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN |
| Protein accession: | AAH02399 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |