View larger

NFAT5 monoclonal antibody (M02), clone 1H16

Reference:

Condition: New product

Data sheet of NFAT5 monoclonal antibody (M02), clone 1H16

Brand:	Abnova
Reference:	H00010725-M02
Product name:	NFAT5 monoclonal antibody (M02), clone 1H16
Product description:	Mouse monoclonal antibody raised against a partial recombinant NFAT5.
Clone:	1H16
Isotype:	IgG2a Kappa
Gene id:	10725
Gene name:	NFAT5
Gene alias:	KIAA0827\|NF-AT5\|NFATL1\|NFATZ\|OREBP\|TONEBP
Gene description:	nuclear factor of activated T-cells 5, tonicity-responsive
Genbank accession:	NM_006599
Immunogen:	NFAT5 (NP_006590.1, 1422 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Protein accession:	NP_006590.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.84 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged NFAT5 is 0.03 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice