Cart 67 Product Products 27 010,06 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD15...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
27 010,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 67 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 010,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 010,06 €
Data sheet of POLD3 monoclonal antibody (M01), clone 3E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about POLD3 monoclonal antibody (M01), clone 3E2
| Brand: | Abnova |
| Reference: | H00010714-M01 |
| Product name: | POLD3 monoclonal antibody (M01), clone 3E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant POLD3. |
| Clone: | 3E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10714 |
| Gene name: | POLD3 |
| Gene alias: | KIAA0039|MGC119642|MGC119643|P66|P68 |
| Gene description: | polymerase (DNA-directed), delta 3, accessory subunit |
| Genbank accession: | NM_006591 |
| Immunogen: | POLD3 (NP_006582, 357 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK |
| Protein accession: | NP_006582 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged POLD3 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proteome-wide analysis of SUMO2 targets in response to pathological DNA replication stress in human cells.Bursomanno S, Beli P, Khan AM, Minocherhomji S, Wagner SA, Bekker-Jensen S, Mailand N, Choudhary C, Hickson ID, Liu Y. DNA Repair (Amst). 2014 Nov 25;25C:84-96. |