CORIN polyclonal antibody (A01) View larger

CORIN polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CORIN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CORIN polyclonal antibody (A01)

Brand: Abnova
Reference: H00010699-A01
Product name: CORIN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CORIN.
Gene id: 10699
Gene name: CORIN
Gene alias: ATC2|CRN|Lrp4|MGC119742|TMPRSS10
Gene description: corin, serine peptidase
Genbank accession: NM_006587
Immunogen: CORIN (NP_006578, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
Protein accession: NP_006578
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010699-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CORIN polyclonal antibody (A01) now

Add to cart