| Brand: | Abnova |
| Reference: | H00010681-M01 |
| Product name: | GNB5 monoclonal antibody (M01), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GNB5. |
| Clone: | 3A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10681 |
| Gene name: | GNB5 |
| Gene alias: | FLJ37457|FLJ43714|GB5 |
| Gene description: | guanine nucleotide binding protein (G protein), beta 5 |
| Genbank accession: | NM_016194 |
| Immunogen: | GNB5 (NP_057278, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEAL |
| Protein accession: | NP_057278 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |