| Brand: | Abnova |
| Reference: | H00010673-M19 |
| Product name: | TNFSF13B monoclonal antibody (M19), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF13B. |
| Clone: | 3G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10673 |
| Gene name: | TNFSF13B |
| Gene alias: | BAFF|BLYS|CD257|DTL|TALL-1|TALL1|THANK|TNFSF20|ZTNF4 |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 13b |
| Genbank accession: | BC020674 |
| Immunogen: | TNFSF13B (AAH20674.1, 118 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD |
| Protein accession: | AAH20674.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TNFSF13B is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |