No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010667-M03 |
| Product name: | FARS2 monoclonal antibody (M03), clone 3F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FARS2. |
| Clone: | 3F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10667 |
| Gene name: | FARS2 |
| Gene alias: | FARS1|HSPC320|PheRS|dJ520B18.2 |
| Gene description: | phenylalanyl-tRNA synthetase 2, mitochondrial |
| Genbank accession: | NM_006567 |
| Immunogen: | FARS2 (NP_006558.1, 351 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF |
| Protein accession: | NP_006558.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged FARS2 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |