Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAMKK2 monoclonal antibody (M02), clone 4C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about CAMKK2 monoclonal antibody (M02), clone 4C7
| Brand: | Abnova |
| Reference: | H00010645-M02 |
| Product name: | CAMKK2 monoclonal antibody (M02), clone 4C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAMKK2. |
| Clone: | 4C7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10645 |
| Gene name: | CAMKK2 |
| Gene alias: | CAMKK|CAMKKB|KIAA0787|MGC15254 |
| Gene description: | calcium/calmodulin-dependent protein kinase kinase 2, beta |
| Genbank accession: | BC026060 |
| Immunogen: | CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP |
| Protein accession: | AAH26060 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.93 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CAMKK2 monoclonal antibody (M02), clone 4C7 Western Blot analysis of CAMKK2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Regulation of Rac1 by simvastatin in endothelial cells: differential roles of AMP-activated protein kinase and calmodulin-dependent kinase kinase-beta.Kou R, Sartoretto J, Michel T. J Biol Chem. 2009 May 29;284(22):14734-43. Epub 2009 Mar 30. |