| Brand: | Abnova |
| Reference: | H00010637-M04 |
| Product name: | LEFTY1 monoclonal antibody (M04), clone 4A3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant LEFTY1. |
| Clone: | 4A3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10637 |
| Gene name: | LEFTY1 |
| Gene alias: | LEFTB|LEFTYB |
| Gene description: | left-right determination factor 1 |
| Genbank accession: | BC027883 |
| Immunogen: | LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
| Protein accession: | AAH27883 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |