Brand: | Abnova |
Reference: | H00010637-A01 |
Product name: | LEFTY1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant LEFTY1. |
Gene id: | 10637 |
Gene name: | LEFTY1 |
Gene alias: | LEFTB|LEFTYB |
Gene description: | left-right determination factor 1 |
Genbank accession: | BC027883 |
Immunogen: | LEFTY1 (AAH27883, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP |
Protein accession: | AAH27883 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |