| Brand: | Abnova |
| Reference: | H00010626-M02 |
| Product name: | TRIM16 monoclonal antibody (M02), clone 5G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM16. |
| Clone: | 5G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10626 |
| Gene name: | TRIM16 |
| Gene alias: | EBBP |
| Gene description: | tripartite motif-containing 16 |
| Genbank accession: | NM_006470 |
| Immunogen: | TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA |
| Protein accession: | NP_006461 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TRIM16 monoclonal antibody (M02), clone 5G11 Western Blot analysis of TRIM16 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |