TRIM16 monoclonal antibody (M01), clone 5F4 View larger

TRIM16 monoclonal antibody (M01), clone 5F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM16 monoclonal antibody (M01), clone 5F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about TRIM16 monoclonal antibody (M01), clone 5F4

Brand: Abnova
Reference: H00010626-M01
Product name: TRIM16 monoclonal antibody (M01), clone 5F4
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM16.
Clone: 5F4
Isotype: IgG2a Kappa
Gene id: 10626
Gene name: TRIM16
Gene alias: EBBP
Gene description: tripartite motif-containing 16
Genbank accession: NM_006470
Immunogen: TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Protein accession: NP_006461
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010626-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010626-M01-42-R01V-1.jpg
Application image note: Western blot analysis of TRIM16 over-expressed 293 cell line, cotransfected with TRIM16 Validated Chimera RNAi ( Cat # H00010626-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM16 monoclonal antibody (M01), clone 5F4 (Cat # H00010626-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy TRIM16 monoclonal antibody (M01), clone 5F4 now

Add to cart