No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010625-M01 |
| Product name: | IVNS1ABP monoclonal antibody (M01), clone 4B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP. |
| Clone: | 4B1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10625 |
| Gene name: | IVNS1ABP |
| Gene alias: | DKFZp686K06216|FLARA3|FLJ10069|FLJ10411|FLJ10962|FLJ35593|FLJ36593|HSPC068|KIAA0850|ND1|NS-1|NS1-BP|NS1BP |
| Gene description: | influenza virus NS1A binding protein |
| Genbank accession: | NM_006469 |
| Immunogen: | IVNS1ABP (NP_006460.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE |
| Protein accession: | NP_006460.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged IVNS1ABP is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |