Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGOLN2 monoclonal antibody (M02), clone 2F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about TGOLN2 monoclonal antibody (M02), clone 2F11
| Brand: | Abnova |
| Reference: | H00010618-M02 |
| Product name: | TGOLN2 monoclonal antibody (M02), clone 2F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TGOLN2. |
| Clone: | 2F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10618 |
| Gene name: | TGOLN2 |
| Gene alias: | MGC14722|TGN38|TGN46|TGN48|TGN51|TTGN2 |
| Gene description: | trans-golgi network protein 2 |
| Genbank accession: | NM_006464 |
| Immunogen: | TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE |
| Protein accession: | NP_006455 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TGOLN2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Distinctive features of degenerating Purkinje cells in spinocerebellar ataxia type 31.Yoshida K, Asakawa M, Suzuki-Kouyama E, Tabata K, Shintaku M, Ikeda S, Oyanagi K Neuropathology. 2014 Jun;34(3):261-7. doi: 10.1111/neup.12090. Epub 2013 Dec 17. |